PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pgl014520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family M-type_MADS
Protein Properties Length: 149aa    MW: 17126.6 Da    PI: 8.7939
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pgl#S29727471PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF922.9e-29959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+ien + rqvtfskRrng+lKKA+ELSvLCdaev +i+fs++gk+ye+ss
  Pgl014520  9 KKIENVTSRQVTFSKRRNGLLKKAYELSVLCDAEVGLIVFSPRGKIYEFSS 59
               68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.609161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.14E-33283IPR002100Transcription factor, MADS-box
CDDcd002652.56E-45276No hitNo description
PRINTSPR004041.4E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MGRGKTQMKK IENVTSRQVT FSKRRNGLLK KAYELSVLCD AEVGLIVFSP RGKIYEFSSR  60
CMQKMLERYQ TYSQESDISN ATKEQDTQER ILTEENVFLS KKCVDQYADS SVLKTPKIQV  120
GSIQDIDVET QLLIRPPIVQ GHPYLDSFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-20190190Myocyte-specific enhancer factor 2B
1tqe_Q3e-20190190Myocyte-specific enhancer factor 2B
1tqe_R3e-20190190Myocyte-specific enhancer factor 2B
1tqe_S3e-20190190Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255589.11e-38PREDICTED: MADS-box protein SOC1
RefseqXP_010255590.11e-38PREDICTED: MADS-box protein SOC1
SwissprotQ9XJ604e-40MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLO244912e-61O24491_PINRA; Putative MADS box transcription factor PrMADS7
STRINGORGLA03G0015400.11e-37(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.32e-37AGAMOUS-like 42